accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
For Use With (Application) 
  • (12)
  • (1)
  • (1)
  • (17)
  • (1)
  • (4)
  • (1)
  • (16)
  • (1)
  • (17)
Form 
  • (13)
  • (1)
Recombinant 
  • (14)
Species 
  • (1)
  • (12)
Conjugate 
  • (2)
Keyword Search: system mopping Clear all selections

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

system mopping

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (12)
  • (2)
  • (4)

For Use With (Application)

  • (12)
  • (1)
  • (1)
  • (17)
  • (1)
  • (4)
  • (1)
  • (16)
  • (1)
  • (17)

Form

  • (13)
  • (1)

Recombinant

  • (14)

Species

  • (1)
  • (12)

Conjugate

  • (2)
1 – 12 of 12 results
2

Invitrogen™ Human PD-1 His-tag Recombinant Protein

Recombinant Protein

Accession Number Q15116
Regulatory Status RUO
Conjugate Unconjugated
Form Lyophilized
Gene ID (Entrez) 5133
Gene Symbol Pdcd1
Source HEK293 cells
Recombinant Recombinant
Name Human PD-1 His-tag
3

Abnova™ Human FLJ10808 Full-length ORF (AAH31637, 1 a.a. - 389 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name UBA6
Molecular Weight (g/mol) 68.31kDa
Gene Symbol UBA6
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name FLJ10808 (Human) Recombinant Protein (P01)
Accession Number AAH31637
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias FLJ10808/FLJ23367/MOP-4/UBE1L2
Gene ID (Entrez) 55236
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
4

Abnova™ Human FLJ10808 Full-length ORF (AAH31637.1, 1 a.a. - 389 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name UBA6
Molecular Weight (g/mol) 69.6kDa
Gene Symbol UBA6
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name FLJ10808 (Human) Recombinant Protein (P02)
Accession Number AAH31637.1
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias FLJ10808/FLJ23367/MOP-4/UBE1L2
Gene ID (Entrez) 55236
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
5

Abnova™ Human SAMHD1 Full-length ORF (NP_056289.2, 1 a.a. - 626 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name SAMHD1
Molecular Weight (g/mol) 98.6kDa
Gene Symbol SAMHD1
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,Protein Array,ELISA,Western Blot
Name SAMHD1 (Human) Recombinant Protein (P01)
Accession Number NP_056289.2
Regulatory Status RUO
Purification Method Glutathione Sepharose 4 Fast Flow
Gene Alias DCIP/HDDC1/MOP-5/SBBI88
Gene ID (Entrez) 25939
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
6

Novus Biologicals™ Recombinant Human SLC7A7 GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1
Molecular Weight (g/mol) MolecularWeight-theroretical: 31.24 kDa
Gene ID (Entrez) 9056
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol SLC7A7
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein SLC7A7
7

Abnova™ Human SLC7A7 Partial ORF (NP_003973.2, 462 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name SLC7A7
Molecular Weight (g/mol) 31.24kDa
Gene Symbol SLC7A7
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name SLC7A7 (Human) Recombinant Protein (Q01)
Accession Number NP_003973.2
Regulatory Status RUO
Gene Alias LAT3/LPI/MOP-2/Y+LAT1/y+LAT-1
Gene ID (Entrez) 9056
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant
8

Abnova™ Human FLJ10808 Partial ORF (NP_060697, 962 a.a. - 1051 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Form Liquid
Common Name UBA6
Molecular Weight (g/mol) 35.64kDa
Gene Symbol UBA6
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System wheat germ expression system
For Use With (Application) Antibody Production,ELISA,Protein Array,Western Blot
Name FLJ10808 (Human) Recombinant Protein (Q01)
Accession Number NP_060697
Regulatory Status RUO
Gene Alias FLJ10808/FLJ23367/MOP-4/UBE1L2
Gene ID (Entrez) 55236
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag GST
Species Wheat Germ (in vitro)
Recombinant Recombinant