accessibility menu, dialog, popup

UserName

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

brands

  • (163)
  • (54)

special programs

  • (40)

Quantity

  • (3)
  • (103)
  • (37)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)

Applications

  • (3)
  • (10)
  • (18)
  • (42)
  • (3)
  • (1)
  • (12)
  • (1)
  • (10)
  • (28)
  • (84)
  • (1)
  • (4)
  • (2)
  • (45)

Conjugate

  • (2)
  • (9)
  • (11)
  • (5)
  • (10)
  • (3)
  • (10)
  • (6)
  • (11)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (4)
  • (1)
  • (5)
  • (4)
  • (4)
  • (1)
  • (4)
  • (49)
  • (4)
  • (3)
  • (4)

Regulatory Status

  • (164)

Target Species

  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (146)
  • (1)
  • (19)
  • (3)
  • (1)
  • (1)
  • (13)
  • (4)
  • (1)
  • (10)

Classification

  • (138)
  • (25)

Form

  • (163)

Host Species

  • (1)
  • (77)
  • (79)
  • (6)

Isotype

  • (55)
  • (41)
  • (14)
  • (17)
  • (12)
  • (15)
  • (9)

For Use With (Application)

  • (5)
  • (5)
  • (5)
  • (1)
  • (5)
1 – 15 of 208 results
2

Human Perforin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. P14222
Antigen Perforin
Regulatory Status RUO
Purification Method Protein A or G purified from cell culture supernatant
Dilution Immunohistochemistry 5-25 ug/mL
Gene Alias Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1
Gene ID (Entrez) 5551
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2771C
3

Human Aggrecan Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG1
Gene Accession No. NP_037359
Antigen Aggrecan
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias ACAN, AGC1, AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16, MSK16AGCAN, SEDK
Gene ID (Entrez) 176
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Mouse myeloma cell line NS0-derived recombinant human Aggrecan, Val20-Gly675, Accession # NP_037359
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 179503
4

Human alpha 2-Macroglobulin Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG1
Antigen alpha 2-Macroglobulin
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias A2M, alpha 2Macroglobulin, Alpha-2-M, alpha-2-macroglobulin, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5, CPAMD5, CPAMD5DKFZp779B086, FWP007, S863-7
Gene ID (Entrez) 2
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Human plasma-derived alpha 2-Macroglobulin
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 257303
5

Mouse IL-36 alpha/IL-1F6 Antibody, R&D Systems™
GREENER_CHOICE

Rat Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications ELISA
Form Purified
Isotype IgG2a
Gene Accession No. Q9JLA2
Antigen IL-36 alpha/IL-1F6
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution ELISA
Gene Alias FIL1, FIL1 epsilon, FIL1(EPSILON), FIL1E, IL-1 epsilon, IL1(EPSILON), IL1E, IL-1E, IL1F6, IL-1F6, IL-1F6 (FIL-1-epsilon), IL36 alpha, IL36A, interleukin 1 family, member 6 (epsilon), interleukin 1, epsilon, Interleukin 36, Alpha, Interleukin-1 epsilon, interleukin-1 family member 6, Interleukin-36 Alpha
Gene ID (Entrez) 27179
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen E. coli-derived recombiMouset mouse IL-36 alpha/IL-1F6, Met1-His160, Accession # Q9JLA2
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 275302
6

Human Desmocollin-1 Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG
Gene Accession No. Q08554
Antigen Desmocollin-1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Immunohistochemistry 3-25 ug/mL
Gene Alias cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1
Gene ID (Entrez) 1823
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Immunogen Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Clone 2906A
7

Derlin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG
Research Discipline ER Markers, Immunology, Lipid and Metabolism, Protein Turnover, Signal Transduction, Unfolded Protein Response
Antigen Derlin 1
Regulatory Status RUO
Purification Method Antigen and protein A Affinity-purified
Dilution Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577
Gene ID (Entrez) 79139
Formulation PBS (pH 7.0)
Immunogen Produced in rabbits immunized with E. coli-derived Human Derlin 1 fragment.
Classification Polyclonal
Primary or Secondary Primary
8

OCTN1/SLC22A4 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Antigen OCTN1/SLC22A4
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:1000-1:2000
Gene Alias Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H
Gene ID (Entrez) 6583
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Classification Polyclonal
Primary or Secondary Primary
9

Human FGFR1 alpha (IIIc) Alexa Fluor™ 647-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

12

Novus Biologicals™ alpha Satellite Repeat Primer

alpha SAT primer for PCR in chromatin precipitation

Content And Storage Store at –20°C. Avoid Free/Thaw Cycles
Product Type alpha Satellite Repeat Primer
For Use With (Application) Chromatin Immunoprecipitation
13

Novus Biologicals™ Recombinant Human DNA Polymerase iota GST (N-Term) Protein

Recombinant Protein

Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Gene Alias DNA polymerase iota, EC 2.7.7.7, Eta2, polymerase (DNA directed) iota, RAD30 homolog B, RAD30Bpolymerase (DNA-directed), iota, RAD3OB
Molecular Weight (g/mol) MolecularWeight-theroretical: 106.7 kDa
Gene ID (Entrez) 11201
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol POLI
Research Category DNA Polymerases, DNA Repair
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein DNA Polymerase iota
14

ErbB2/Her2 Antibody (rERBB2/9401), Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Store at 4°C.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG2b κ
Research Discipline Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Concentration 0.2 mg/mL
Antigen ErbB2/Her2
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunohistochemistry-Paraffin : 1-2 μg/mL
Gene Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Gene ID (Entrez) 2064
Formulation 10 mM PBS with 0.05% BSA
Immunogen Recombinant fragment (around aa1155-1255) of human ErbB2/Her2 protein (exact sequence is proprietary)
Classification Monoclonal
Primary or Secondary Primary
Clone rERBB2/9401
15

MMP-14/MT1-MMP Antibody (S05-6H5), Novus Biologicals™

Rabbit Monoclonal Antibody

Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,ELISA,Immunohistochemistry,Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG
Research Discipline Cancer, Extracellular Matrix
Concentration 0.3 mg/mL
Antigen MMP-14/MT1-MMP
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot, ELISA, Immunohistochemistry 1:50, Immunocytochemistry/ Immunofluorescence 1:10-1:2000, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA 1:100-1:2000
Gene Alias EC 3.4.24, EC 3.4.24.80, matrix metallopeptidase 14 (membrane-inserted), matrix metalloproteinase 14 (membrane-inserted), matrix metalloproteinase-14, membrane type 1 metalloprotease, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP-14, MMP-X1, MT1MMP, MT1-MMPMTMMP1, MT-MMP 1
Gene ID (Entrez) 4323
Formulation 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA
Immunogen A synthetic peptide of human MMP-14/MT1-MMP (Uniprot # P50281)
Classification Monoclonal
Primary or Secondary Primary
Clone S05-6H5