Search Results Page | Fisher Scientific

Narrow Results

brands

Bio-Techne (205)
Novus Biologicals (57,187)
R&D Systems (34)

special programs

Greener Choice (14)

Protein State

Denatured (2)
Native (14,849)

Recombinant

Native (1)
Recombinant (2,312)

Host Species

Canine (2)
Chicken (2)
Goat (4)
Human (499)
Mouse (235)
Non-species Specific (1)
Primate (5)
Rabbit (295)
Rat (23)

Form

Ascites (2)
Liquid (3)
Lyophilized (2)
Purified (652)

1 – 15 of 49,702 results

Novus Biologicals™ Flagellin Native Protein

Native Protein

Pricing and Availability

Recombinant Proteins

Novus Biologicals™ Recombinant Protein A Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>97% pure by SDS-PAGE and HPLC
Gene Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Molecular Weight (g/mol)	33.4 kDa
Gene ID (Entrez)	3919448
Formulation	Lyophilized from additive free solution.
Research Category	Epitope Tags
Reconstitution	Dissolve in distilled water or saline.
Endotoxin Concentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Concentration	LYOPH
For Use With (Application)	PAGE,Bioactivity,HPLC
Protein	Protein A

Novus Biologicals™ Human Heart Whole Tissue Lysate (Adult Whole Normal)

Pricing and Availability

Tissue Lysates

R&D Systems™ Human Thrombospondin-1 Quantikine ELISA Kit

Human Thrombospondin-1 Quantikine ELISA Kit from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.

Pricing and Availability

Life Science Research ELISA Kits

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>95%, by SDS-PAGE
Gene Alias	alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Gene ID (Entrez)	6622
Formulation	PBS pH 7.4
Gene Symbol	SNCA
Research Category	Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Storage Requirements	Store at -80C. Avoid freeze-thaw cycles.
For Use With (Application)	Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Protein	alpha-Synuclein

Novus Biologicals™ Recombinant Human XRCC1 GST (N-Term) Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster
Molecular Weight (g/mol)	MolecularWeight-theroretical: 95.26 kDa
Gene ID (Entrez)	7515
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	XRCC1
Research Category	Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	XRCC1

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing and Availability
Specifications

Recombinant Proteins

Conjugate	Unconjugated
Gene Symbol	SNCA
For Use With (Application)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Source	E.Coli
Name	Human alpha-Synuclein Aggregate Protein
Regulatory Status	RUO
Purification Method	>95% pure by SDS-PAGE
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Product Type	Recombinant Protein
Gene ID (Entrez)	6622
Formulation	PBS
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Cross Reactivity	Human
Recombinant	Recombinant

Novus Biologicals™ Recombinant Human UBE2R1/CDC34 Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>95%, by SDS-PAGE and HPLC
Gene Alias	cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1
Molecular Weight (g/mol)	MolecularWeight-theroretical: 26.7 kDa
Gene ID (Entrez)	997
Formulation	A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT.
Gene Symbol	CDC34
Research Category	Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Endotoxin Concentration	Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method.
Storage Requirements	Store at -20°C. Avoid freeze/thaw cycles.
For Use With (Application)	SDS-PAGE
Protein	UBE2R1/CDC34

Novus Biologicals™ Recombinant Mouse LIGHT/TNFSF14 Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>95%, by SDS-PAGE and HPLC
Gene Alias	CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT
Molecular Weight (g/mol)	MolecularWeight-theroretical: 18.4 kDa
Gene ID (Entrez)	8740
Formulation	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
Gene Symbol	TNFSF14
Research Category	Apoptosis
Reconstitution	Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.)
Endotoxin Concentration	Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.)
For Use With (Application)	Western Blot,Bioactivity
Protein	LIGHT/TNFSF14

Novus Biologicals™ Recombinant Human IFN-gamma Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>98% pure by SDS-PAGE and HPLC
Molecular Weight (g/mol)	16.9 kDa
Gene Symbol	IFNG
Endotoxin Concentration	Less than 1 EU/ug of IFN-gamma as determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Concentration	LYOPH
For Use With (Application)	PAGE,Bioactivity
Protein	IFN-gamma
Accession Number	P01579
Gene Alias	IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma
Gene ID (Entrez)	3458
Formulation	Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Research Category	Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers
Reconstitution	Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C.

Novus Biologicals™ Recombinant Protein G Cys (N-Term) Protein

Recombinant Protein

Pricing and Availability

Recombinant Proteins

Novus Biologicals™ Recombinant Protein A Cys (C-Term) Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Purity or Quality Grade	>98% pure by SDS-PAGE and HPLC
Gene Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Molecular Weight (g/mol)	33.5 kDa
Gene ID (Entrez)	3919448
Formulation	Lyophilized from additive free solution.
Research Category	Biologically Active Proteins, Epitope Tags
Reconstitution	Reconstitute with distilled water or saline.
Endotoxin Concentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Concentration	LYOPH
For Use With (Application)	PAGE,Bioactivity
Protein	Protein A

Novus Biologicals™ Mouse Brain Whole Tissue Lysate (Adult Whole Normal)

Pricing and Availability

Tissue Lysates

Novus Biologicals™ Recombinant Bacteria Listeria monocytogenes p60 His Protein

Recombinant Protein

Pricing and Availability
Specifications

Recombinant Proteins

Accession Number	P21171
Purity or Quality Grade	>90% SDS-PAGE
Gene Alias	IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein
Molecular Weight (g/mol)	M.W. Theoretical: 50 kDa
Formulation	Liquid. 0.2um-filtered solution in PBS, pH 7.2
Research Category	Immunology
Endotoxin Concentration	<1 EU/μg purified protein (LAL test; Lonza).
Storage Requirements	Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5 mg/ml
For Use With (Application)	SDS-PAGE
Protein	Listeria monocytogenes p60

Novus Biologicals™ WDR5 Protein

Highly purified. Generating reliable and reproducible results.

Pricing and Availability
Specifications

Recombinant Proteins

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	WDR5
Molecular Weight (g/mol)	38.8kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE

Prev
1
2
3
4
5
6
...
3,314
Next

Filtered Search Results

Narrow Results