missing translation for 'onlineSavingsMsg'
Learn More
Learn More
17 beta-HSD1/HSD17B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-39053
This item is not returnable.
View return policy
Description
17 beta-HSD1/HSD17B1 Polyclonal specifically detects 17 beta-HSD1/HSD17B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| 17 beta-HSD1/HSD17B1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P14061 | |
| HSD17B1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG | |
| 0.1 mL | |
| Breast Cancer, Cancer | |
| 3292 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction