missing translation for 'onlineSavingsMsg'
Learn More

PIK3CA Antibody [Alexa Fluor« 647], Novus Biologicals Biologicals™

Product Code. 30487969 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30487969 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30487969 Supplier Novus Biologicals Supplier No. NBP335708AF647

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PIK3CA Polyclonal antibody specifically detects PIK3CA in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen PIK3CA
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 647
Formulation 50mM Sodium Borate
Gene Alias EC 2.7.1, EC 2.7.1.153, MGC142161, MGC142163, p110-alpha, Phosphatidylinositol 3-Kinase catalytic subunit alpha, phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha, phosphatidylinositol 3-kinase, catalytic, alpha polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit alpha, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, alpha isoform, phosphoinositide-3-kinase, catalytic, alpha polypeptide, PI3K, PI3K-alpha, PI3-kinase p110 subunit alpha, PI3-kinase subunit alpha, PtdIns-3-kinase p110, PtdIns-3-kinase subunit alpha, PtdIns-3-kinase subunit p110-alpha
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 401-600 of human PIK3CA (NP_006209.2).,, Sequence:, ERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Diabetes Research, mTOR Pathway, Oncogenes
Primary or Secondary Primary
Gene ID (Entrez) 5290
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.