missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | CPT2 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | DyLight 350 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?