missing translation for 'onlineSavingsMsg'
Learn More

CPT2 Antibody [DyLight 350], Novus Biologicals Biologicals™

Product Code. 30488843 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity
30488843 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30488843 Supplier Novus Biologicals Supplier No. NBP338018UV

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen CPT2
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate DyLight 350
Formulation 50mM Sodium Borate
Gene Alias carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1376
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.