missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Filamin B Polyclonal antibody specifically detects Filamin B in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Filamin B |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | DyLight 650 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | ABP-278filamin B, beta (actin binding protein 278), ABP-280 homolog, actin binding protein 278, Actin-binding-like protein, AOI, Beta-filamin, DKFZp686O033, Fh1, filamin B, beta, Filamin homolog 1, filamin-3, filamin-B, FLN1L, FLN3, FLN-B, Larsen syndrome 1 (autosomal dominant), LRS1, SCT, TABPABP-280, TAPDKFZp686A1668, Thyroid autoantigen, Truncated ABP, Truncated actin-binding protein |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human Filamin B (NP_001157789.1).,, Sequence:, PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?