missing translation for 'onlineSavingsMsg'
Learn More
Learn More
A20/TNFAIP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68857-25ul
This item is not returnable.
View return policy
Description
A20/TNFAIP3 Polyclonal antibody specifically detects A20/TNFAIP3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| A20/TNFAIP3 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| A20TNFA1P2, EC 3.4.19.12, EC 6.3.2.-, MGC104522, MGC138687, OTU domain-containing protein 7C, OTUD7CMGC138688, Putative DNA-binding protein A20, TNF alpha-induced protein 3, tumor necrosis factor alpha-induced protein 3, tumor necrosis factor inducible protein A20, tumor necrosis factor, alpha-induced protein 3, Zinc finger protein A20 | |
| This A20/TNFAIP3 Antibody was developed against a recombinant protein corresponding to amino acids: AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV | |
| 25 μL | |
| Cancer, Inflammation, Innate Immunity, Necroptosis, Neurodegeneration, Signal Transduction | |
| 7128 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction