missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14250-25ul
This item is not returnable.
View return policy
Description
ABCA7 Polyclonal antibody specifically detects ABCA7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ABCA7 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8IZY2 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| ABCA-SSN, ABCXATP-binding cassette sub-family A member 7, ATP-binding cassette, sub-family A (ABC1), member 7, Autoantigen SS-N, EC 2.2.1.1, EC 3.6.3, EC 3.6.3.41, FLJ40025, Macrophage ABC transporter | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRRQPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL | |
| 25 μL | |
| ABC Transporters, Cellular Markers, Cholesterol Metabolism, Glia Markers, Golgi Apparatus Markers, Lipid and Metabolism, Neuroscience, Plasma Membrane Markers, Signal Transduction | |
| 10347 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction