missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCB10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38749
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
ABCB10 Polyclonal specifically detects ABCB10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| ABCB10 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9NRK6 | |
| ABCB10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE | |
| 0.1 mL | |
| ABC Transporters, Lipid and Metabolism | |
| 23456 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering