missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCC9 Antibody (S319A-14), Alexa Fluor™ 405, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-22403AF405
This item is not returnable.
View return policy
Description
ABCC9 Monoclonal specifically detects ABCC9 in Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
Specifications
| ABCC9 | |
| Monoclonal | |
| Alexa Fluor 405 | |
| 50mM Sodium Borate with 0.05% Sodium Azide | |
| ABCC9 | |
| Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A | |
| 0.1 mL | |
| 10060 | |
| Mouse | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| S319A-14 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
| ABC37, ATP-binding cassette, sub-family C (CFTR/MRP), member 9, CMD1OATP-binding cassette transporter sub-family C member 9, EC 3.6.3.44, FLJ36852, Sulfonylurea receptor 2, sulfonylurea receptor 2A, SUR2ATP-binding cassette sub-family C member 9 | |
| Mouse | |
| Protein G purified | |
| Primary | |
| Detects approx 120kDa. Does not cross-react with SUR2B. | |
| Store at 4C in the dark. | |
| IgG2a |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction