missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACAP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14257
This item is not returnable.
View return policy
Description
ACAP3 Polyclonal specifically detects ACAP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ACAP3 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q96P50 | |
| ACAP3 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ANK repeat and PH domain-containing protein 3, ArfGAP with coiled-coil, ankyrin repeat and PH domains 3, centaurin, beta 5, centaurin-beta-5, CENTB5, cnt-b5, KIAA1716 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 116983 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction