missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACAP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48550-25ul
This item is not returnable.
View return policy
Description
ACAP4 Polyclonal antibody specifically detects ACAP4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ACAP4 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ARF6 GTPase-activating protein, arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1, centaurin, beta 6, CENTB6, DDEFL1, development and differentiation enhancing factor-like 1, Development and differentiation-enhancing factor-like 1, FLJ20199, Protein up-regulated in liver cancer 1, UPLC1ACAP4, up-regulated in liver cancer 1 (UPLC1) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDLLSVLEAFA | |
| 25 μL | |
| Lipid and Metabolism | |
| 55616 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction