missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
c-Myb Polyclonal antibody specifically detects c-Myb in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | c-Myb |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | c-myb, Cmyb, c-myb protein (140 AA), c-myb_CDS, c-myb10A_CDS, c-myb13A_CDS, c-myb14A_CDS, c-myb8B_CDS, efg, Proto-oncogene c-Myb, transcriptional activator Myb, v-myb avian myeloblastosis viral oncogene homolog, v-myb myeloblastosis viral oncogene homolog (avian) |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?