missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACOT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | ACOT2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637346
|
Novus Biologicals
NBP2-62632-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631728
|
Novus Biologicals
NBP2-62632 |
100 μg |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACOT2 Polyclonal antibody specifically detects ACOT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ACOT2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10965 | |
| IgG | |
| Protein A purified |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| acyl-CoA thioesterase 2MTE1, Acyl-coenzyme A thioester hydrolase 2a, acyl-coenzyme A thioesterase 2, mitochondrial, CTE-Ia, EC 3.1.2.2, Long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, mitochondrial acyl-CoA thioesterase 2, peroxisomal long-chain acyl-coA thioesterase 2, PTE2A, PTE2CTE1A, ZAP128Mte1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title