missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACSL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | ACSL3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18292551
|
Novus Biologicals
NBP2-58817 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626257
|
Novus Biologicals
NBP2-58817-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACSL3 Polyclonal specifically detects ACSL3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ACSL3 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| ACS3EC 6.2.1.3, acyl-CoA synthetase long-chain family member 3, FACL3lignoceroyl-CoA synthase, fatty-acid-Coenzyme A ligase, long-chain 3, LACS 3, LACS3, Long-chain acyl-CoA synthetase 3, long-chain-fatty-acid--CoA ligase 3, PRO2194 | |
| ACSL3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 2181 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title