missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACSM2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | ACSM2A |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18656465
|
Novus Biologicals
NBP2-46841-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18690076
|
Novus Biologicals
NBP2-46841 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACSM2A Polyclonal antibody specifically detects ACSM2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ACSM2A | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology | |
| PBS (pH 7.2), 40% Glycerol | |
| 123876 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| A-923A4.1, ACSM2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title