missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85415
This item is not returnable.
View return policy
Description
ADAM2 Polyclonal specifically detects ADAM2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ADAM2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q99965 | |
| ADAM2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGHPCGLNQWICIDGVCMSGDK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADAM metallopeptidase domain 2, Cancer/testis antigen 15, CRYN2, CT15ADAM 2, disintegrin and metalloproteinase domain-containing protein 2, EC 3.4.24, fertilin beta, Fertilin subunit beta, FTNBCRYN1, PH-30, PH-30b, PH30PH30-beta | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 2515 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction