missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 572.00
Specifications
| Antigen | ADI1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18697005
|
Novus Biologicals
NBP2-38251-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18147377
|
Novus Biologicals
NBP2-38251 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ADI1 Polyclonal specifically detects ADI1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ADI1 | |
| Polyclonal | |
| Rabbit | |
| metabolism, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, Acireductone dioxygenase (Ni(2+)-requiring), acireductone dioxygenase 1, APL1, ARDsubmergence induced protein 2, EC 1.13.11.53, FLJ10913, HMFT1638, membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, MTCBP1, MTCBP-1, Ni-ARD, SIPLMT1-MMP cytoplasmic tail-binding protein-1, Submergence-induced protein 2 homolog | |
| ADI1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9BV57 | |
| 55256 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEAR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title