missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21383
This item is not returnable.
View return policy
Description
ADK Polyclonal antibody specifically detects ADK in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
| ADK | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| adenosine kinase, AKAdenosine 5'-phosphotransferase, EC 2.7.1, EC 2.7.1.20 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD | |
| 100 μg | |
| Cancer, Cell Cycle and Replication, Immunology, Lipid and Metabolism | |
| 132 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction