missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AE Binding Protein 1/ACLP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-49432-25ul
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
AE Binding Protein 1/ACLP Polyclonal antibody specifically detects AE Binding Protein 1/ACLP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifica
| AE Binding Protein 1/ACLP | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| ACLP, ACLPadipocyte enhancer binding protein 1, AE binding protein 1, AE-binding protein 1adipocyte enhancer-binding protein 1, Aortic carboxypeptidase-like protein, FLJ33612 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 165 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto