missing translation for 'onlineSavingsMsg'
Learn More

AFP, Mouse anti-Human, Clone: 1G7, Abnova™

Mouse Monoclonal Antibody

Brand: Abnova H00000174-M01.100ug

Product Code. 16164444

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

Specifications

Antigen	AFP
Classification	Monoclonal
Conjugate	Unconjugated
Gene	alpha-fetoprotein
Gene Alias	FETA/HPAFP
Host Species	Mouse
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Clone	1G7
Formulation	In 1x PBS, pH 7.4
Gene Accession No.	BC027881
Gene Symbols	AFP
Immunogen	AFP (AAH27881, 500 a.a. ∼ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Regulatory Status	RUO
Gene ID (Entrez)	174
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

AFP, Mouse anti-Human, Clone: 1G7, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions