missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AgRP/ART Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 415.00 - € 589.00
Specifications
| Antigen | AgRP/ART |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18472961
|
Novus Biologicals
NBP1-89203-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18231816
|
Novus Biologicals
NBP1-89203 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AgRP/ART Polyclonal specifically detects AgRP/ART in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| AgRP/ART | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| agouti related protein homolog (mouse), agouti-related protein, Agrt, AGRTMGC118963, ARTagouti (mouse) related protein, ASIP2 | |
| AGRP | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cardiovascular Biology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 181 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title