missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AHR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89975
This item is not returnable.
View return policy
Description
AHR Polyclonal antibody specifically detects AHR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| AHR | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Ah receptor, AhR, AH-receptor, aryl hydrocarbon receptor, BHLHE76, bHLHe76aromatic hydrocarbon receptor, Class E basic helix-loop-helix protein 76 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE | |
| 0.1 mL | |
| Apoptosis, Breast Cancer, Cancer, Chromatin Research, Hypoxia, Innate Immunity, Transcription Factors and Regulators | |
| 196 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction