missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alcohol dehydrogenase 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49350
This item is not returnable.
View return policy
Description
alcohol dehydrogenase 5 Polyclonal antibody specifically detects alcohol dehydrogenase 5 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| alcohol dehydrogenase 5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ADH-3, ADHXEC 1.1.1.1, alcohol dehydrogenase (class III), chi polypeptide, Alcohol dehydrogenase 5, alcohol dehydrogenase 5 (class III), chi polypeptide, Alcohol dehydrogenase class chi chain, alcohol dehydrogenase class-3, Alcohol dehydrogenase class-III, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.284, FALDH, FDHGSNOR, formaldehyde dehydrogenase, Glutathione-dependent formaldehyde dehydrogenase, GSH-FDH, S-(hydroxymethyl)glutathione dehydrogenase | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSI | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 128 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction