missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMFR/gp78 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 484.00
Specifications
| Antigen | AMFR/gp78 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
AMFR/gp78 Polyclonal specifically detects AMFR/gp78 in Human samples. It is validated for Western Blot.Specifications
| AMFR/gp78 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q6PGR1 | |
| 267 | |
| Synthetic peptides corresponding to AMFR(autocrine motility factor receptor) The peptide sequence was selected from the C terminal of AMFR. Peptide sequence FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK. | |
| Primary | |
| 73 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| AMF receptor, AMF receptor, isoform 1, AMF receptor, isoform 2, autocrine motility factor receptor, Autocrine motility factor receptor, isoform 2, gp78, RING finger protein 45, RNF45EC 6.3.2.- | |
| AMFR | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title