missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ANKS4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91672-25ul
This item is not returnable.
View return policy
Description
ANKS4B Polyclonal specifically detects ANKS4B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ANKS4B | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q8N8V4 | |
| ANKS4B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VALLDKAATAQNIMNPKKVTRLKEQAQKNARRQIKECERLQEKHQNKMAHTYSKEESGTLSSSKGTFSRSSPSNASAP | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ankyrin repeat and sterile alpha motif domain containing 4B, FLJ38819harmonin-interacting ankyrin-repeat containing protein, Harmonin-interacting ankyrin repeat-containing protein, Harp, HARPankyrin repeat and SAM domain-containing protein 4B, MGC133380, MGC133381 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 257629 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction