missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16118935

AOC3, Mouse, Clone: 4B8, Abnova™

Product Code. 16118935
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16118935 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16118935 Supplier Abnova Supplier No. H00008639M06.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant AOC3.

Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The product is a major protein on the adipocyte plasma membrane. It has adhesive properties and also has functional monoamine oxidase activity. A pseudogene for this gene has been discribed and is located approximately 9kb downstream. [provided by RefSeq

Sequence: DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQAPKTIRDAFCVFEQNQGLPLRRHHSDLYSH

Specifications

Antigen AOC3,
Applications ELISA, Immunofluorescence
Classification Monoclonal
Clone 4B8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant AOC3.
Formulation PBS with no preservative; pH 7.4
Gene AOC3
Gene Accession No. NM_003734
Gene Alias HPAO/SSAO/VAP-1/VAP1
Gene Symbols AOC3
Host Species Mouse
Immunogen AOC3 (NP_003725, 351 a.a. ∼ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8639
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.