missing translation for 'onlineSavingsMsg'
Learn More

SPEG complex locus, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human APEG1 protein.

Brand: Abnova H00010290-B01.50uL

Product Code. 16156828

€ 349.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Expression of this gene is thought to serve as a marker for differentiated vascular smooth muscle cells which may have a role in regulating growth and differentiation of this cell type. The encoded protein is highly similar to the corresponding rat and mouse proteins. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of only one variant has been defined. [provided by RefSeq

Sequence: MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

Specifications

Antigen	SPEG complex locus
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a full-length human APEG1 protein.
Gene	SPEG
Gene Alias	APEG1/BPEG/KIAA1297/MGC12676/SPEGalpha/SPEGbeta
Host Species	Mouse
Quantity	50 μL
Research Discipline	Cell Cycle
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	Western Blot
Conjugate	Unconjugated
Formulation	No additive
Gene Accession No.	BC006346.2
Gene Symbols	SPEG
Immunogen	APEG1 (AAH06346.1, 1 a.a. ∼ 113 a.a) full-length human protein.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	10290
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

SPEG complex locus, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions