missing translation for 'onlineSavingsMsg'
Learn More
Learn More
apelin, Mouse, Polyclonal Antibody, Abnova™
Description
Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM
Sequence: MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Specifications
Specifications
| Antigen | apelin |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Mouse polyclonal antibody raised against a full-length human APLN protein. |
| Formulation | No additive |
| Gene | APLN |
| Gene Accession No. | BC021104 |
| Gene Alias | XNPEP2 |
| Gene Symbols | APLN |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?