missing translation for 'onlineSavingsMsg'
Learn More

carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CHST2.

Brand: Abnova H00009435-A01.50uL

Product Code. 16100626

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue (Uchimura et al., 1998 [PubMed 9722682]).[supplied by OMIM

Sequence: DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Specifications

Antigen	carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant CHST2.
Gene	CHST2
Gene Alias	C6ST/GST2
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	9435
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_004267
Gene Symbols	CHST2
Immunogen	CHST2 (NP_004258, 431 a.a. ∼ 530 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions