missing translation for 'onlineSavingsMsg'
Learn More

claudin 10, Mouse, Polyclonal Antibody, Abnova™

Product Code. 16113252
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16113252 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16113252 Supplier Abnova Supplier No. H00009071B01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse polyclonal antibody raised against a full-length human CLDN10 protein.

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

Specifications

Antigen claudin 10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human CLDN10 protein.
Formulation No additive
Gene CLDN10
Gene Accession No. BC010920
Gene Alias CPETRL3/OSP-L
Gene Symbols CLDN10
Host Species Mouse
Immunogen CLDN10 (AAH10920, 1 a.a. ∼ 228 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cell Adhesion
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9071
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.