missing translation for 'onlineSavingsMsg'
Learn More

CLK3, Mouse, Clone: 5B2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLK3.

Brand: Abnova H00001198-M04.100ug

Product Code. 16156424

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq

Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV

Specifications

Antigen	CLK3
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC002555
Gene Symbols	CLK3
Immunogen	CLK3 (AAH02555, 36 a.a. ∼ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2b κ

Applications	ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clone	5B2
Description	Mouse monoclonal antibody raised against a partial recombinant CLK3.
Gene	CLK3
Gene Alias	FLJ22858/PHCLK3/PHCLK3/152
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	1198
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

CLK3, Mouse, Clone: 5B2, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions