missing translation for 'onlineSavingsMsg'
Learn More

EPOR, Mouse, Clone: 3F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EPOR.

Brand: Abnova H00002057-M02.100ug

Product Code. 16137754

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. [provided by RefSeq

Sequence: PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA

Specifications

Antigen	EPOR
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_000121
Gene Symbols	EPOR
Immunogen	EPOR (NP_000112, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2b κ

Applications	ELISA, Western Blot
Clone	3F6
Description	Mouse monoclonal antibody raised against a partial recombinant EPOR.
Gene	EPOR
Gene Alias	MGC138358
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	2057
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

EPOR, Mouse, Clone: 3F6, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions