missing translation for 'onlineSavingsMsg'
Learn More

FOXO1A, Mouse, Clone: 4D9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant FOXO1A.

Brand: Abnova H00002308-M05.100ug

Product Code. 16034035

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq

Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Specifications

Antigen	FOXO1A
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002015
Gene Symbols	FOXO1
Immunogen	FOXO1A (NP_002006, 556 a.a. ∼ 655 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2a κ

Applications	ELISA, Western Blot
Clone	4D9
Description	Mouse monoclonal antibody raised against a partial recombinant FOXO1A.
Gene	FOXO1
Gene Alias	FKH1/FKHR/FOXO1A
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	2308
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

FOXO1A, Mouse, Clone: 4D9, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions