missing translation for 'onlineSavingsMsg'
Learn More

GLRA1, Mouse, Clone: 3F1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GLRA1.

Brand: Abnova H00002741-M05.100ug

Product Code. 16118734

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is a subunit of a pentameric inhibitory glycine receptor. The receptor mediates postsynaptic inhibition in the central nervous system. Defects in this gene are a cause of startle disease (STHE), also known as hereditary hyperekplexia or congenital stiff-person syndrome. Two transcript variants encoding different isoforms have been found for this gene

Sequence: IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE

Specifications

Antigen	GLRA1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_000171
Gene Symbols	GLRA1
Immunogen	GLRA1 (NP_000162, 121 a.a. ∼ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2a κ

Applications	ELISA, Western Blot
Clone	3F1
Description	Mouse monoclonal antibody raised against a partial recombinant GLRA1.
Gene	GLRA1
Gene Alias	MGC138878/MGC138879/STHE
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	2741
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

GLRA1, Mouse, Clone: 3F1, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions