missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16115576

gremlin 1, cysteine knot superfamily, homolog (Xenopus laevis), Mouse, Clone: 2F1, Abnova™

Product Code. 16115576
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16115576 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16115576 Supplier Abnova Supplier No. H00026585M06.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a partial recombinant GREM1.

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to relay the sonic hedgehog (SHH) signal from the polarizing region to the apical ectodermal ridge during limb bud outgrowth. [provided by RefSeq

Sequence: ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD

Specifications

Antigen gremlin 1, cysteine knot superfamily, homolog (Xenopus laevis)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2F1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GREM1.
Formulation PBS with no preservative; pH 7.4
Gene GREM1
Gene Accession No. NM_013372
Gene Alias CKTSF1B1/DAND2/DRM/GREMLIN/IHG-2/MGC126660/PIG2
Gene Symbols GREM1
Host Species Mouse
Immunogen GREM1 (NP_037504, 75 a.a. ∼ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neurobiology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 26585
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.