missing translation for 'onlineSavingsMsg'
Learn More

GTF2A1, Mouse, Clone: 2H5, Abnova™

Product Code. 16139034
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16139034 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16139034 Supplier Abnova Supplier No. H00002957M01.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse monoclonal antibody raised against a partial recombinant GTF2A1.

Sequence: MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEE

Specifications

Antigen GTF2A1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2H5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant GTF2A1.
Formulation PBS with no preservative; pH 7.4
Gene GTF2A1
Gene Accession No. NM_015859
Gene Alias MGC129969/MGC129970/TF2A1/TFIIA
Gene Symbols GTF2A1
Host Species Mouse
Immunogen GTF2A1 (NP_056943, 1 a.a. ∼ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2957
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.