missing translation for 'onlineSavingsMsg'
Learn More

interleukin 17F, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human IL17F protein.

Brand: Abnova H00112744-D01P.100ug

Product Code. 16185509

€ 365.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq

Sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Specifications

Antigen	interleukin 17F
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against a full-length human IL17F protein.
Gene	IL17F
Gene Alias	IL-17F/ML-1/ML1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_052872
Gene Symbols	IL17F
Immunogen	IL17F (NP_443104.1, 1 a.a. ∼ 163 a.a) full-length human protein.
Quantity	100 μg
Research Discipline	Cytokines
Gene ID (Entrez)	112744
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

interleukin 17F, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions