missing translation for 'onlineSavingsMsg'
Learn More

myeloid cell leukemia sequence 1 (BCL2-related), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MCL1.

Brand: Abnova H00004170-A02.50uL

Product Code. 16171055

€ 242.00 / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene belongs to the Bcl-2 family. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. [provided by RefSeq

Sequence: GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM

Specifications

Antigen	myeloid cell leukemia sequence 1 (BCL2-related)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant MCL1.
Gene	MCL1
Gene Alias	BCL2L3/EAT/MCL1L/MCL1S/MGC104264/MGC1839/TM
Host Species	Mouse
Quantity	50 μL
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_021960
Gene Symbols	MCL1
Immunogen	MCL1 (NP_068779, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Gene ID (Entrez)	4170
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

myeloid cell leukemia sequence 1 (BCL2-related), Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions