missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16143473

MMS19 nucleotide excision repair homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Product Code. 16143473
Change view
Click to view available options
Quantity:
50 μL
Unit Size:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16143473 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16143473 Supplier Abnova Supplier No. H00064210B01.50uL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a full-length human MMS19 protein.

Sequence: MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS

Specifications

Antigen MMS19 nucleotide excision repair homolog (S. cerevisiae)
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human MMS19 protein.
Formulation No additive
Gene MMS19
Gene Accession No. BC007298
Gene Alias FLJ34167/FLJ95146/MET18/MGC99604/MMS19L/hMMS19
Gene Symbols MMS19
Host Species Mouse
Immunogen MMS19 (AAH07298, 1 a.a. ∼ 293 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 64210
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.