missing translation for 'onlineSavingsMsg'
Learn More

NDP, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NDP protein.

Brand: Abnova H00004693-B02P.50ug

Product Code. 16141715

€ 349.00 / 50µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

This gene encodes a secreted protein with a cystein-knot motif that activates the Wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in Norrie disease and X-linked exudative vitreoretinopathy. [provided by RefSeq

Sequence: MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Specifications

Antigen	NDP
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a full-length human NDP protein.
Gene	NDP
Gene Alias	EVR2/FEVR/ND
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	4693
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_000266.1
Gene Symbols	NDP
Immunogen	NDP (NP_000257.1,1 a.a. ∽ 133 a.a) full-length human protein.
Quantity	50 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

NDP, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions