Learn More
retinoblastoma binding protein 4, Mouse, Clone: 4A5, Abnova™
Mouse monoclonal antibody raised against a partial recombinant RBBP4.
Brand: Abnova H00005928-M02.100ug
Description
This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Sequence: HKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS*Specifications
| retinoblastoma binding protein 4 | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_005610 | |
| RBBP4 | |
| RBBP4 (NP_005601, 316 a.a. ∼ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Cell Cycle | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Immunofluorescence, Western Blot | |
| 4A5 | |
| Mouse monoclonal antibody raised against a partial recombinant RBBP4. | |
| RBBP4 | |
| NURF55/RBAP48 | |
| Mouse | |
| Affinity Purified | |
| RUO | |
| Yes | |
| 5928 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG2a κ |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.