missing translation for 'onlineSavingsMsg'
Learn More

RNA binding motif, single stranded interacting protein, Mouse, Clone: 3B11, Abnova™

Product Code. 16135856
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16135856 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16135856 Supplier Abnova Supplier No. H00027303M02.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse monoclonal antibody raised against a partial recombinant RBMS3.

The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: QPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK*

Specifications

Antigen RNA binding motif, single stranded interacting protein
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3B11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant RBMS3.
Formulation PBS with no preservative; pH 7.4
Gene RBMS3
Gene Accession No. NM_014483.3
Gene Symbols RBMS3
Host Species Mouse
Immunogen RBMS3 (NP_055298.2, 311 a.a. ∼ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 27303
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.