missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16170442

S100 calcium binding protein A7 (D03P), Rabbit anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Product Code. 16170442
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16170442 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16170442 Supplier Abnova Supplier No. H00006278D03P.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit polyclonal antibody raised against a full-length human S100A7 protein.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq

Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Specifications

Antigen S100 calcium binding protein A7
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human S100A7 protein.
Formulation PBS with no preservative; pH 7.4
Gene S100A7
Gene Accession No. BC034687
Gene Alias PSOR1/S100A7c
Gene Symbols S100A7
Host Species Rabbit
Immunogen S100A7 (AAH34687.1, 1 a.a. ∼ 101 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6278
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.