missing translation for 'onlineSavingsMsg'
Learn More

transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila), Mouse, Clone: 2E4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant TLE6.

Brand: Abnova H00079816-M01.100ug

Product Code. 16124513

€ 349.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: MATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY

Specifications

Antigen	transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila)
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC020206
Gene Symbols	TLE6
Immunogen	TLE6 (AAH20206, 1 a.a. ∼ 449 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Signal Transduction
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Western Blot
Clone	2E4
Description	Mouse monoclonal antibody raised against a full length recombinant TLE6.
Gene	TLE6
Gene Alias	FLJ14009/GRG6/MGC14966
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	79816
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila), Mouse, Clone: 2E4, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions