missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AP3B2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 624.00
Tekniske data
| Antigen | AP3B2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
18427980
|
Novus Biologicals
NBP1-81011-25ul |
25ul |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18242246
|
Novus Biologicals
NBP1-81011 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
AP3B2 Polyclonal specifically detects AP3B2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| AP3B2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Adapter-related protein complex 3 subunit beta-2, Adaptor protein complex AP-3 subunit beta-2, adaptor-related protein complex 3, beta 2 subunit, beta-3B-adaptin, Clathrin assembly protein complex 3 beta-2 large chain, DKFZp686D17136, NAPTBAP-3 complex subunit beta-2, Neuronal adaptin-like protein, beta-subunit, Neuron-specific vesicle coat protein beta-NAP | |
| AP3B2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Q13367 | |
| 8120 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel