missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apc11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35554-20ul
This item is not returnable.
View return policy
Description
Apc11 Polyclonal antibody specifically detects Apc11 in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| Apc11 | |
| Polyclonal | |
| Western Blot 1:200 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| anaphase promoting complex subunit 11, anaphase promoting complex subunit 11 (yeast APC11 homolog), anaphase-promoting complex subunit 11, APC11 anaphase promoting complex subunit 11 homolog, APC11Hepatocellular carcinoma-associated RING finger protein, Apc11p, Cyclosome subunit 11, HSPC214, MGC882 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human Apc11 (NP_001002245.1).,, Sequence:, MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE | |
| 20 μL | |
| Cell Cycle and Replication | |
| 51529 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction