Learn More
Invitrogen™ APC2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595377
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Cell cycle regulated protein ubiquitination and degradation within subcellular domains is thought to be essential for the normal progression of mitosis. APC2 is a highly conserved component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. APC/C is responsible for degrading anaphase inhibitors, mitotic cyclins, and spindle-associated proteins ensuring that events of mitosis take place in proper sequence. The individual APC/C components mRNA and protein levels are expressed at approximately the same levels in most tissues and cell lines, suggesting that they perform their functions as part of a complex. Like APC11, APC2 contains cullin and RING finger domains that are thought to be important in regulating ubiquitination activity.
Specifications
| APC2 | |
| Polyclonal | |
| Unconjugated | |
| APC2 | |
| 9230107K09Rik; adenomatosis polyposis coli 2; adenomatous polyposis coli like; adenomatous polyposis coli protein 2; Adenomatous polyposis coli protein-like; AI852447; AL024279; Anapc2; anaphase promoting complex subunit 2; anaphase-promoting complex subunit 2; APC2; APC2, WNT signaling pathway regulator; APCL; APC-like; Cyclosome subunit 2; EGK_07151; Emi4; expressed during mesenchymal induction 4; Imi4; induced during mesenchymal induction 4; KIAA1406; mKIAA1406; R75424 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 10297 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| O95996 | |
| APC2 | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.