missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APH1A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 463.00
Specifications
| Antigen | APH1A |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18612402
|
Novus Biologicals
NBP2-92623-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676762
|
Novus Biologicals
NBP2-92623-0.1ml |
0.1 mL |
€ 463.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
APH1A Polyclonal antibody specifically detects APH1A in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| APH1A | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Stem Cell Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 51107 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| 6530402N02Rik, anterior pharynx defective 1 homolog A (C. elegans), APH-1, APH-1A, aph-1alpha, CGI-78, gamma-secretase subunit APH-1A, Presenilin-stabilization factor, PSF | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human APH1A (NP_001071096.1). TSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title